Structure of PDB 1kuj Chain A

Receptor sequence

>1kujA (length=133) Species: 3490 (Artocarpus integer)

GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL

3D structure

• PDB: 1kuj Structural basis for the unusual carbohydrate-binding specificity of jacalin towards galactose and mannose.
• Chain: A
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	T72 V79 F104 D125 Y126 F127 S128 M129 Y130 L131	T72 V79 F104 D125 Y126 F127 S128 M129 Y130 L131
BS02	peptide	A	N105 P107 E109 N110 L133	N105 P107 E109 N110 L133
BS03	peptide	A	T10 F60 P61 L112 L133	T10 F60 P61 L112 L133
BS04	MMA	A	G1 F47 Y78 G121 Y122 W123 D125	G1 F47 Y78 G121 Y122 W123 D125

Gene Ontology

Molecular Function

• GO:0019862 IgA binding
• GO:0030246 carbohydrate binding

Biological Process

• GO:0008150 biological_process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:1kuj, PDBe:1kuj, PDBj:1kuj
• PDBsum: 1kuj
• PubMed: 11988090
• UniProt: P18670|LECA_ARTIN Agglutinin alpha chain