Structure of PDB 1ktg Chain A

Receptor sequence
>1ktgA (length=137) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
VVKAAGLVIYRKLAGKIEFLLLQASYPPHHWTPPKGHVDPGEDEWQAAIR
ETKEEANITKEQLTIHEDCHETLFYEAKGKPKSVKYWLAKLNNPDDVQLS
HEHQNWKWCELEDAIKIADYAEMGSLLRKFSAFLAGF
3D structure
PDB1ktg The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PO4 A G37 H38 E52 E103 G36 H37 E51 E102
BS02 MG A K36 E56 K35 E55
BS03 MG A E52 E56 E103 E51 E55 E102
BS04 AMP A P29 H31 K36 Y76 K83 Y121 P28 H30 K35 Y75 K82 Y120
Gene Ontology
Molecular Function
GO:0004081 bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity
GO:0005524 ATP binding
GO:0008796 bis(5'-nucleosyl)-tetraphosphatase activity
GO:0016787 hydrolase activity
GO:0043135 5-phosphoribosyl 1-pyrophosphate pyrophosphatase activity
Biological Process
GO:0006167 AMP biosynthetic process
GO:0006172 ADP biosynthetic process
GO:0006754 ATP biosynthetic process
GO:0006915 apoptotic process
GO:0015967 diadenosine tetraphosphate catabolic process
GO:0019693 ribose phosphate metabolic process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ktg, PDBe:1ktg, PDBj:1ktg
PDBsum1ktg
PubMed11937063
UniProtQ9U2M7|AP4A_CAEEL Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] (Gene Name=ndx-4)

[Back to BioLiP]