Structure of PDB 1ksz Chain A

Receptor sequence

>1kszA (length=431) Species: 562 (Escherichia coli) [Search protein sequence]

GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKT
VLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGIPVRERLLLS
EACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGD
LFDKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSM
VVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVAT
GSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGAT
TGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMP
DGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA

3D structure

PDB

1ksz Entrapment of 6-thiophosphoryl-IMP in the active site of crystalline adenylosuccinate synthetase from Escherichia coli.

Chain

Resolution

2.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D13 K16 G40 H41 Q224
Catalytic site (residue number reindexed from 1)	D13 K16 G40 H41 Q224
Enzyme Commision number	6.3.4.4: adenylosuccinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	MG	A	D13 G40	D13 G40
BS02	GDP	A	D13 G15 K16 K18 G40 H41 T42 K331 D333 S414 T415 G416 P417	D13 G15 K16 K18 G40 H41 T42 K331 D333 S414 T415 G416 P417
BS03	HDA	A	D13 G40 G298 A299 T300 T301	D13 G40 G298 A299 T300 T301
BS04	PGS	A	D13 K16 N38 A39 G40 H41 G127 T128 T129 A223 Q224 L228 V273 G274	D13 K16 N38 A39 G40 H41 G127 T128 T129 A223 Q224 L228 V273 G274

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0000287	magnesium ion binding
GO:0004019	adenylosuccinate synthase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016874	ligase activity
GO:0046872	metal ion binding
GO:0097216	guanosine tetraphosphate binding

	Biological Process
GO:0006164	purine nucleotide biosynthetic process
GO:0006974	DNA damage response
GO:0015949	nucleobase-containing small molecule interconversion
GO:0044208	'de novo' AMP biosynthetic process
GO:0046040	IMP metabolic process
GO:0046086	adenosine biosynthetic process

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ksz, PDBe:1ksz, PDBj:1ksz
PDBsum	1ksz
PubMed	9182542
UniProt	P0A7D4\|PURA_ECOLI Adenylosuccinate synthetase (Gene Name=purA)

[Back to BioLiP]