Structure of PDB 1ksh Chain A

Receptor sequence
>1kshA (length=165) Species: 10090 (Mus musculus) [Search protein sequence]
RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNI
WDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEER
LAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGED
LLPGIDWLLDDISSR
3D structure
PDB1ksh The complex of Arl2-GTP and PDE delta: from structure to function.
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q70
Catalytic site (residue number reindexed from 1) Q56
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A T30 T47 T16 T33
BS02 GDP A N26 A27 G28 K29 T30 T31 N125 K126 D128 S158 A159 V160 N12 A13 G14 K15 T16 T17 N111 K112 D114 S144 A145 V146
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019003 GDP binding
Biological Process
GO:0006110 regulation of glycolytic process
GO:0007098 centrosome cycle
GO:0010811 positive regulation of cell-substrate adhesion
GO:0031113 regulation of microtubule polymerization
GO:0031116 positive regulation of microtubule polymerization
GO:0034260 negative regulation of GTPase activity
GO:0051457 maintenance of protein location in nucleus
GO:0070830 bicellular tight junction assembly
GO:1903715 regulation of aerobic respiration
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005925 focal adhesion
GO:0016328 lateral plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ksh, PDBe:1ksh, PDBj:1ksh
PDBsum1ksh
PubMed11980706
UniProtQ9D0J4|ARL2_MOUSE ADP-ribosylation factor-like protein 2 (Gene Name=Arl2)

[Back to BioLiP]