Structure of PDB 1kp4 Chain A |
>1kp4A (length=122) Species: 1935 (Streptomyces violaceoruber) [Search protein sequence] |
APADKPQVLASFTQTSASSQNAWLAANRNQSAWAAYEFDWSTDLCTQAPD NPFGFPFNTACARHDFGYRNYKAAGSFDANKSRIDSAFYEDMKRVCTGYT GEKNTACNSTAWTYYQAVKIFG |
|
PDB | 1kp4 The crystal structure of prokaryotic phospholipase A2. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D43 L44 D65 |
D43 L44 D65 |
|
|
|
|