Structure of PDB 1klq Chain A

Receptor sequence

>1klqA (length=197) Species: 9606 (Homo sapiens) [Search protein sequence]

GSITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTD
LELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDK
TAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTD
KDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND

3D structure

PDB

1klq The Mad2 spindle checkpoint protein undergoes similar major conformational changes upon binding to either Mad1 or Cdc20.

Chain

Resolution

N/A

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	V70 W77 F153 D154 L155 L156 I157 Y158 T159 L163 V164 V165 K168 W169 E170 E171 S172 G173 P174 F176	V60 W67 F143 D144 L145 L146 I147 Y148 T149 L153 V154 V155 K158 W159 E160 E161 S162 G163 P164 F166

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity

	Biological Process
GO:0000070	mitotic sister chromatid segregation
GO:0000132	establishment of mitotic spindle orientation
GO:0007094	mitotic spindle assembly checkpoint signaling
GO:0042177	negative regulation of protein catabolic process
GO:0043066	negative regulation of apoptotic process
GO:0045930	negative regulation of mitotic cell cycle
GO:0051301	cell division
GO:0051660	establishment of centrosome localization
GO:0090267	positive regulation of mitotic cell cycle spindle assembly checkpoint
GO:1904667	negative regulation of ubiquitin protein ligase activity

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000776	kinetochore
GO:0000922	spindle pole
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0033597	mitotic checkpoint complex
GO:0044615	nuclear pore nuclear basket
GO:0048471	perinuclear region of cytoplasm
GO:0072686	mitotic spindle
GO:1990728	mitotic spindle assembly checkpoint MAD1-MAD2 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1klq, PDBe:1klq, PDBj:1klq
PDBsum	1klq
PubMed	11804586
UniProt	Q13257\|MD2L1_HUMAN Mitotic spindle assembly checkpoint protein MAD2A (Gene Name=MAD2L1)

[Back to BioLiP]