Structure of PDB 1kll Chain A |
>1kllA (length=128) Species: 1914 (Streptomyces lavendulae) [Search protein sequence] |
ARISLFAVVVEDMAKSMEFYRKMGVEIPAEADSAPHTEAVLDGGIRLAWD TVETVRSYDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLK PWNAVWGQRYAIVKDPDGNVVDLFAPLP |
|
PDB | 1kll Molecular basis of mitomycin C resistance in streptomyces: structure and function of the MRD protein. |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MC |
A |
L7 H38 D52 Y60 |
L5 H36 D50 Y58 |
PDBbind-CN: -logKd/Ki=5.20,Kd=6.3uM |
|
|