Structure of PDB 1keb Chain A

Receptor sequence

>1kebA (length=108) Species: 562 (Escherichia coli)

SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQ
GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLK
EFLDANLA

3D structure

• PDB: 1keb Structural Consequences of Replacement of an alpha-helical Pro Residue in E.coli Thioredoxin
• Chain: A
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	A	S1 D2	S1 D2

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0015035 protein-disulfide reductase activity
• GO:0015036 disulfide oxidoreductase activity
• GO:0030337 DNA polymerase processivity factor activity

Biological Process

• GO:0045454 cell redox homeostasis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1keb, PDBe:1keb, PDBj:1keb
• PDBsum: 1keb
• PubMed: 12364576
• UniProt: P0AA25|THIO_ECOLI Thioredoxin 1 (Gene Name=trxA)