Structure of PDB 1kdj Chain A

Receptor sequence
>1kdjA (length=102) Species: 13818 (Adiantum capillus-veneris) [Search protein sequence]
AKVEVGDEVGNFKFYPDSITVSAGEAVEFTLVGETGHNIVFDIPAGAPGT
VASELKAASMDENDLLSEDEPSFKAKVSTPGTYTFYCTPHKSANMKGTLT
VK
3D structure
PDB1kdj The structure and unusual pH dependence of plastocyanin from the fern Dryopteris crassirhizoma. The protonation of an active site histidine is hindered by pi-pi interactions.
ChainA
Resolution1.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H37 C87 H90 M95
Catalytic site (residue number reindexed from 1) H37 C87 H90 M95
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU A H37 C87 H90 H37 C87 H90
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
Cellular Component
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1kdj, PDBe:1kdj, PDBj:1kdj
PDBsum1kdj
PubMed10206999
UniProtQ7SIB8|PLAS_DRYCA Plastocyanin (Gene Name=PETE)

[Back to BioLiP]