Structure of PDB 1kb6 Chain A

Receptor sequence
>1kb6A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
PRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITK
DNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEE
3D structure
PDB1kb6 Structural basis of VDR-DNA interactions on direct repeat response elements.
ChainA
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A F34 H35 F36 R49 I94 L95 V100 F14 H15 F16 R29 I74 L75 V80
BS02 dna A E42 G43 F47 R50 R73 R74 Q77 R80 I107 E22 G23 F27 R30 R53 R54 Q57 R60 I87
BS03 ZN A C24 C27 C41 C44 C4 C7 C21 C24
BS04 ZN A C60 C66 C76 C79 C40 C46 C56 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1kb6, PDBe:1kb6, PDBj:1kb6
PDBsum1kb6
PubMed11980721
UniProtP11473|VDR_HUMAN Vitamin D3 receptor (Gene Name=VDR)

[Back to BioLiP]