Structure of PDB 1kb4 Chain A

Receptor sequence
>1kb4A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
RICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKD
NRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEE
3D structure
PDB1kb4 Structural basis of VDR-DNA interactions on direct repeat response elements.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A F34 H35 F36 K45 R49 I94 L95 R104 F13 H14 F15 K24 R28 I73 L74 R83
BS02 dna A G43 F47 R50 R73 R74 R80 I107 G22 F26 R29 R52 R53 R59 I86
BS03 ZN A C24 C27 C41 C44 C3 C6 C20 C23
BS04 ZN A C60 C66 C76 C79 C39 C45 C55 C58
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1kb4, PDBe:1kb4, PDBj:1kb4
PDBsum1kb4
PubMed11980721
UniProtP11473|VDR_HUMAN Vitamin D3 receptor (Gene Name=VDR)

[Back to BioLiP]