Structure of PDB 1ka7 Chain A

Receptor sequence
>1ka7A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGY
IYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQY
PVEKKSS
3D structure
PDB1ka7 A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A E17 Y50 I51 Y52 T53 Y54 E67 T68 V72 G93 E17 Y50 I51 Y52 T53 Y54 E67 T68 V72 G93
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
Biological Process
GO:0002250 adaptive immune response
GO:0006959 humoral immune response
GO:0006968 cellular defense response
GO:0007267 cell-cell signaling
GO:0030101 natural killer cell activation
GO:0042267 natural killer cell mediated cytotoxicity
GO:0045087 innate immune response
GO:0045954 positive regulation of natural killer cell mediated cytotoxicity
GO:0050776 regulation of immune response
GO:0050860 negative regulation of T cell receptor signaling pathway
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ka7, PDBe:1ka7, PDBj:1ka7
PDBsum1ka7
PubMed11823424
UniProtO60880|SH21A_HUMAN SH2 domain-containing protein 1A (Gene Name=SH2D1A)

[Back to BioLiP]