Structure of PDB 1k6t Chain A |
>1k6tA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGI GGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
|
PDB | 1k6t Lack of synergy for inhibitors targeting a multi-drug-resistant HIV-1 protease. |
Chain | A |
Resolution | 2.25 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
XN1 |
A |
R8 D25 G48 G49 |
R8 D25 G48 G49 |
PDBbind-CN: -logKd/Ki=7.62,Kd=24nM |
|
|
|