Structure of PDB 1k6o Chain A

Receptor sequence
>1k6oA (length=89) Species: 9606 (Homo sapiens) [Search protein sequence]
SAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKP
NMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEIL
3D structure
PDB1k6o Crystal structure of a ternary SAP-1/SRF/c-fos SRE DNA complex.
ChainA
Resolution3.19 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y356 R361 R364 Y367 K374 F380 Y54 R59 R62 Y65 K72 F78
BS02 dna A T306 W345 K349 K351 K358 Y366 T4 W43 K47 K49 K56 Y64
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1k6o, PDBe:1k6o, PDBj:1k6o
PDBsum1k6o
PubMed11846562
UniProtP28324|ELK4_HUMAN ETS domain-containing protein Elk-4 (Gene Name=ELK4)

[Back to BioLiP]