Structure of PDB 1k68 Chain A |
>1k68A (length=140) Species: 1188 (Tolypothrix sp. PCC 7601) [Search protein sequence] |
AHKKIFLVEDNKADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEY ANASRPDLILLDLNLPKKDGREVLAEIKSDPTLKRIPVVVLSTSINEDDI FHSYDLHVNCYITKSANLSQLFQIVKGIEEFWLSTATLPS |
|
PDB | 1k68 Crystal structures of two cyanobacterial response regulators in apo- and phosphorylated form reveal a novel dimerization motif of phytochrome-associated response regulators |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
D18 X70 N72 |
D10 X62 N64 |
|
|
|
|