Structure of PDB 1k0t Chain A

Receptor sequence
>1k0tA (length=80) Species: 32049 (Picosynechococcus sp. PCC 7002) [Search protein sequence]
SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVGC
KRCETACPTDFLSIRVYLGAETTRSMGLAY
3D structure
PDB1k0t Solution structure of the unbound, oxidized Photosystem I subunit PsaC, containing [4Fe-4S] clusters F(A) and F(B): a conformational change occurs upon binding to photosystem I.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.97.1.12: photosystem I.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 SF4 A T9 C10 I11 C13 T14 Q15 C16 V17 C57 T9 C10 I11 C13 T14 Q15 C16 V17 C57
BS02 SF4 A A19 C20 L22 V24 C47 G49 C50 R52 C53 A19 C20 L22 V24 C47 G49 C50 R52 C53
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0009773 photosynthetic electron transport in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1k0t, PDBe:1k0t, PDBj:1k0t
PDBsum1k0t
PubMed11941504
UniProtP31087|PSAC_PICP2 Photosystem I iron-sulfur center (Gene Name=psaC)

[Back to BioLiP]