Structure of PDB 1k0n Chain A

Receptor sequence
>1k0nA (length=226) Species: 9606 (Homo sapiens) [Search protein sequence]
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETV
QKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNT
AGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVSQR
KFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYA
REEFASTCPDDEEIELAYEQVAKALK
3D structure
PDB1k0n Crystal structure of a soluble form of the intracellular chloride ion channel CLIC1 (NCC27) at 1.4-A resolution.
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GSH A K13 C24 F26 L64 D76 T77 K8 C19 F21 L59 D71 T72
Gene Ontology
Molecular Function
GO:0005254 chloride channel activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0045296 cadherin binding
Biological Process
GO:0006821 chloride transport
GO:0007165 signal transduction
GO:0034220 monoatomic ion transmembrane transport
GO:0045669 positive regulation of osteoblast differentiation
GO:0051881 regulation of mitochondrial membrane potential
GO:0070527 platelet aggregation
GO:1902476 chloride transmembrane transport
Cellular Component
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum
GO:0005886 plasma membrane
GO:0005903 brush border
GO:0016020 membrane
GO:0031965 nuclear membrane
GO:0031982 vesicle
GO:0034707 chloride channel complex
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1k0n, PDBe:1k0n, PDBj:1k0n
PDBsum1k0n
PubMed11551966
UniProtO00299|CLIC1_HUMAN Chloride intracellular channel protein 1 (Gene Name=CLIC1)

[Back to BioLiP]