Structure of PDB 1jtk Chain A

Receptor sequence

>1jtkA (length=131) Species: 1423 (Bacillus subtilis)

MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIENAAYSM
CNCAERTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELCTKD
VIVVLTNLQGQIKEMTVEELLPGAFSSEDLH

3D structure

• PDB: 1jtk Crystal structure of the tetrameric cytidine deaminase from Bacillus subtilis at 2.0 A resolution.
• Chain: A
• Resolution: 2.04 Å

Enzymatic activity

• Enzyme Commision number: 3.5.4.5: cytidine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C53 C86 C89	C53 C86 C89
BS02	THU	A	V26 N42 E44 C53 E55 P85 C86	V26 N42 E44 C53 E55 P85 C86

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009972 cytidine deamination
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0072527 pyrimidine-containing compound metabolic process
• GO:1901135 carbohydrate derivative metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1jtk, PDBe:1jtk, PDBj:1jtk
• PDBsum: 1jtk
• PubMed: 11851403
• UniProt: P19079|CDD_BACSU Cytidine deaminase (Gene Name=cdd)