Structure of PDB 1jtb Chain A

Receptor sequence
>1jtbA (length=91) Species: 4513 (Hordeum vulgare) [Search protein sequence]
LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNC
LKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY
3D structure
PDB1jtb Barley lipid-transfer protein complexed with palmitoyl CoA: the structure reveals a hydrophobic binding site that can expand to fit both large and small lipid-like ligands.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 COA A L1 N2 C3 G4 V6 D7 M10 L14 L51 I54 L1 N2 C3 G4 V6 D7 M10 L14 L51 I54
BS02 PLM A V6 M10 L34 H35 V47 L51 I69 P70 V77 Y79 I81 V6 M10 L34 H35 V47 L51 I69 P70 V77 Y79 I81
Gene Ontology
Biological Process
GO:0006869 lipid transport
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jtb, PDBe:1jtb, PDBj:1jtb
PDBsum1jtb
PubMed9032083
UniProtP07597|NLTP1_HORVU Non-specific lipid-transfer protein 1 (Gene Name=LTP1)

[Back to BioLiP]