Structure of PDB 1jsc Chain A

Receptor sequence

>1jscA (length=541) Species: 4932 (Saccharomyces cerevisiae)

PDMDTSFVGLTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFN
FVLPKHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADAFADGI
PMVVFTGQVPTSAIGTDAFQEADVVGISRSCTKWNVMVKSVEELPLRINE
AFEIATSGRPGPVLVDLPKDVTAAILRNPIPTKTTLPSAQDEFVMQSINK
AADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTTLQGLGSF
DQEDPKSLDMLGMHGCATANLAVQNADLIIAVGARFDDRVTGNISKFAPE
ARRAAAEGRGGIIHFEVSPKNINKVVQTQIAVEGDATTNLGKMMSKIFPV
KERSEWFAQINKWKKEYPYAYMEETPGSKIKPQTVIKKLSKVANDTGRHV
IVTTGVGQHQMWAAQHWTWRNPHTFITSGGLGTMGYGLPAAIGAQVAKPE
SLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNNEESHTHQLNPDFIK
LAEAMGLKGLRVKKQEELDAKLKEFVSTKGPVLLEVEVDKK

3D structure

• PDB: 1jsc Crystal structure of yeast acetohydroxyacid synthase: a target for herbicidal inhibitors.
• Chain: A
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y113 G115 G116 A117 I118 E139 T162 F201 Q202 E203 K251 M354 V381 V497 G523 M525 D550 N577 E579 K647
• Catalytic site (residue number reindexed from 1): Y31 G33 G34 A35 I36 E57 T80 F119 Q120 E121 K169 M263 V290 V406 G432 M434 D459 N486 E488 K540
• Enzyme Commision number: 2.2.1.6: acetolactate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D550 N577	D459 N486
BS02	2HP	A	G115 G116 Q202	G33 G34 Q120
BS03	TPP	A	V497 G498 Q499 H500 M525 D550 A551 S552 N577	V406 G407 Q408 H409 M434 D459 A460 S461 N486
BS04	FAD	A	R241 G307 A308 G309 N312 T334 L335 L352 G353 H355 G374 A375 R376 D378 R380 V381 E407 V408 N412 G425 D426 A427	R159 G216 A217 G218 N221 T243 L244 L261 G262 H264 G283 A284 R285 D287 R289 V290 E316 V317 N321 G334 D335 A336
BS05	TPP	A	Y113 P114 E139 P165	Y31 P32 E57 P83

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003824 catalytic activity
• GO:0003984 acetolactate synthase activity
• GO:0016740 transferase activity
• GO:0030976 thiamine pyrophosphate binding
• GO:0046872 metal ion binding
• GO:0050660 flavin adenine dinucleotide binding

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009082 branched-chain amino acid biosynthetic process
• GO:0009097 isoleucine biosynthetic process
• GO:0009099 L-valine biosynthetic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005948 acetolactate synthase complex

External links

• PDB: RCSB:1jsc, PDBe:1jsc, PDBj:1jsc
• PDBsum: 1jsc
• PubMed: 11902841
• UniProt: P07342|ILVB_YEAST Acetolactate synthase catalytic subunit, mitochondrial (Gene Name=ILV2)