Structure of PDB 1jqd Chain A

Receptor sequence

>1jqdA (length=286) Species: 9606 (Homo sapiens)

MRSLFHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKI
LSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTS
NLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLK
FFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQ
MLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPP
DLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA

3D structure

• PDB: 1jqd Two polymorphic forms of human histamine methyltransferase: structural, thermal, and kinetic comparisons.
• Chain: A
• Resolution: 2.28 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.8: histamine N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	A	G60 E89 P90 Q94 T119 S120 I142 Q143 M144 Y147	G54 E83 P84 Q88 T113 S114 I136 Q137 M138 Y141	MOAD: Ki=6.9uM PDBbind-CN: -logKd/Ki=5.16,Ki=6.9uM BindingDB: Ki=18100nM
BS02	HSM	A	F22 E28 Q143 N283	F16 E22 Q137 N277

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity
• GO:0008170 N-methyltransferase activity
• GO:0046539 histamine N-methyltransferase activity

Biological Process

• GO:0001692 histamine metabolic process
• GO:0001695 histamine catabolic process
• GO:0006548 L-histidine catabolic process
• GO:0007585 respiratory gaseous exchange by respiratory system
• GO:0032259 methylation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005813 centrosome
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1jqd, PDBe:1jqd, PDBj:1jqd
• PDBsum: 1jqd
• PubMed: 11566133
• UniProt: P50135|HNMT_HUMAN Histamine N-methyltransferase (Gene Name=HNMT)