Structure of PDB 1jni Chain A

Receptor sequence
>1jniA (length=62) Species: 727 (Haemophilus influenzae) [Search protein sequence]
QPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKV
PRRYFCLQCHVS
3D structure
PDB1jni The 1.25 A resolution structure of the diheme NapB subunit of soluble nitrate reductase reveals a novel cytochrome c fold with a stacked heme arrangement.
ChainA
Resolution1.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A P39 T73 I75 S76 T78 H79 R95 F97 C98 C101 H102 P2 T36 I38 S39 T41 H42 R53 F55 C56 C59 H60
BS02 HEC A P40 V42 P43 H44 V46 Y49 C58 C61 H62 A72 T73 H102 P3 V5 P6 H7 V9 Y12 C21 C24 H25 A35 T36 H60
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0009061 anaerobic respiration
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jni, PDBe:1jni, PDBj:1jni
PDBsum1jni
PubMed11939777
UniProtP44654|NAPB_HAEIN Periplasmic nitrate reductase, electron transfer subunit (Gene Name=napB)

[Back to BioLiP]