Structure of PDB 1jne Chain A

Receptor sequence

>1jneA (length=400) Species: 7227 (Drosophila melanogaster)

SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAY
SMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLL
EGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHK
EQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLA
TFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSN
KINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAE
ICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSY
DDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL

3D structure

• PDB: 1jne Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D128 A130 Q132 F222
• Catalytic site (residue number reindexed from 1): D127 A129 Q131 F202

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MAN	A	H242 A251	H222 A231

Gene Ontology

Molecular Function

• GO:0008061 chitin binding
• GO:0008084 imaginal disc growth factor receptor binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0006032 chitin catabolic process
• GO:0007444 imaginal disc development
• GO:0008284 positive regulation of cell population proliferation
• GO:0043066 negative regulation of apoptotic process

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space

External links

• PDB: RCSB:1jne, PDBe:1jne, PDBj:1jne
• PDBsum: 1jne
• PubMed: 11821393
• UniProt: Q9V3D4|IDGF2_DROME Chitinase-like protein Idgf2 (Gene Name=Idgf2)