Structure of PDB 1jmt Chain A

Receptor sequence
>1jmtA (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
SQTIALLNIYRNPQDGLRSAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEE
MNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSP
3D structure
PDB1jmt A novel peptide recognition mode revealed by the X-ray structure of a core U2AF35/U2AF65 heterodimer.
ChainA
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A E80 E84 E88 M89 N131 N132 R133 W134 F135 N136 G137 P139 I140 H141 E32 E36 E40 M41 N83 N84 R85 W86 F87 N88 G89 P91 I92 H93
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0089701 U2AF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jmt, PDBe:1jmt, PDBj:1jmt
PDBsum1jmt
PubMed11551507
UniProtQ01081|U2AF1_HUMAN Splicing factor U2AF 35 kDa subunit (Gene Name=U2AF1)

[Back to BioLiP]