Structure of PDB 1jlk Chain A |
>1jlkA (length=141) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] |
NPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGE YENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDD VIASYELHVNCYLTKSRNLKDLFKMVQGIESFWLETVTLPA |
|
PDB | 1jlk Crystal structure of a cyanobacterial phytochrome response regulator. |
Chain | A |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
D16 D68 N70 |
D11 D63 N65 |
|
|
|
|