Structure of PDB 1jk0 Chain A

Receptor sequence

>1jk0A (length=334) Species: 4932 (Saccharomyces cerevisiae)

LNKELETLREENRVKSDMLKEKLSKDAENHKAYLKSHQVHRHKLKEMEKE
EPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNR
MNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMI
ENIHSETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRWIQDAD
ALFGERLVAFASIEGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGL
HTDFACLLFAHLKNKPDPAIVEKIVTEAVEIEQRYFLDALPVALLGMNAD
LMNQYVEFVADRLLVAFGNKKYYKVENPFDFMEN

3D structure

• PDB: 1jk0 Structure of the yeast ribonucleotide reductase Y2Y4 heterodimer.
• Chain: A
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y183 D272
• Catalytic site (residue number reindexed from 1): Y158 D247
• Enzyme Commision number: 1.17.4.1: ribonucleoside-diphosphate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	E176 E239 E273 H276	E151 E214 E248 H251

Gene Ontology

Molecular Function

• GO:0004748 ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0046982 protein heterodimerization activity
• GO:0060090 molecular adaptor activity

Biological Process

• GO:0009263 deoxyribonucleotide biosynthetic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005971 ribonucleoside-diphosphate reductase complex

External links

• PDB: RCSB:1jk0, PDBe:1jk0, PDBj:1jk0
• PDBsum: 1jk0
• PubMed: 11526233
• UniProt: P09938|RIR2_YEAST Ribonucleoside-diphosphate reductase small chain 1 (Gene Name=RNR2)