Structure of PDB 1jj4 Chain A

Receptor sequence
>1jj4A (length=74) Species: 333761 (human papillomavirus 18) [Search protein sequence]
MTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTKTGILTVTYHSE
TQRTKFLNTVAIPDSVQILVGYMT
3D structure
PDB1jj4 The structural basis of DNA target discrimination by papillomavirus E2 proteins.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R296 K300 R303 Y304 R307 S318 T319 R11 K15 R18 Y19 R22 S33 T34 PDBbind-CN: Kd=1.6nM
BS02 dna A N297 S298 C301 R305 S355 N12 S13 C16 R20 S65 PDBbind-CN: Kd=1.6nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jj4, PDBe:1jj4, PDBj:1jj4
PDBsum1jj4
PubMed10906136
UniProtP06790|VE2_HPV18 Regulatory protein E2 (Gene Name=E2)

[Back to BioLiP]