Structure of PDB 1ji5 Chain A

Receptor sequence

>1ji5A (length=142) Species: 1392 (Bacillus anthracis)

QVIEVLNKQVADWSVLFTKLHNFHWYVKGPQFFTLHEKFEELYTESATHI
DEIAERILAIGGKPVATMKEYLEISSIQEAAYGETAEGMVEAIMKDYEMM
LVELKKGMEIAQNSDDEMTSDLLLGIYTELEKHAWMLRAFLN

3D structure

• PDB: 1ji5 Structure of two iron-binding proteins from Bacillus anthracis.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 1.16.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	A	D54 E58	D51 E55

Gene Ontology

Molecular Function

• GO:0008199 ferric iron binding
• GO:0016491 oxidoreductase activity
• GO:0016722 oxidoreductase activity, acting on metal ions
• GO:0046872 metal ion binding

Biological Process

• GO:0006879 intracellular iron ion homeostasis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1ji5, PDBe:1ji5, PDBj:1ji5
• PDBsum: 1ji5
• PubMed: 11836250
• UniProt: Q8RPQ2|DPS2_BACAN DNA protection during starvation protein 2 (Gene Name=dps2)