Structure of PDB 1jg6 Chain A

Receptor sequence

>1jg6A (length=351) Species: 10665 (Tequatrovirus T4)

MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKS
FDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTD
IRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKK
VDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMV
EFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQA
IAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYV
NNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAID
L

3D structure

• PDB: 1jg6 High resolution crystal structures of T4 phage beta-glucosyltransferase: induced fit and effect of substrate and metal binding.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E22 F72 D100 R191
• Catalytic site (residue number reindexed from 1): E22 F72 D100 R191
• Enzyme Commision number: 2.4.1.27: DNA beta-glucosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UDP	A	V18 G188 S189 R191 R195 F213 G214 K237 I238 M240 V243 R269 E272	V18 G188 S189 R191 R195 F213 G214 K237 I238 M240 V243 R269 E272

Gene Ontology

Molecular Function

• GO:0016757 glycosyltransferase activity
• GO:0033821 DNA beta-glucosyltransferase activity

Biological Process

• GO:0006304 DNA modification
• GO:0019049 virus-mediated perturbation of host defense response
• GO:0052170 symbiont-mediated suppression of host innate immune response
• GO:0099018 symbiont-mediated evasion of host restriction-modification system

External links

• PDB: RCSB:1jg6, PDBe:1jg6, PDBj:1jg6
• PDBsum: 1jg6
• PubMed: 11493010
• UniProt: P04547|GSTB_BPT4 DNA beta-glucosyltransferase (Gene Name=bgt)