Structure of PDB 1jfp Chain A

Receptor sequence

>1jfpA (length=309) Species: 9913 (Bos taurus) [Search protein sequence]

LAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFG
GFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVV
CKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGI
DYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQE
SATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMT
IPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSK
TETSQVAPA

3D structure

PDB

1jfp Studies on the structure of the G-protein-coupled receptor rhodopsin including the putative G-protein binding site in unactivated and activated forms.

Chain

Resolution

N/A

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RET	A	E113 G121 L125 F208 F212 A295 K296	E74 G82 L86 F169 F173 A256 K257

Gene Ontology

	Molecular Function
GO:0001965	G-protein alpha-subunit binding
GO:0002046	opsin binding
GO:0004930	G protein-coupled receptor activity
GO:0005085	guanyl-nucleotide exchange factor activity
GO:0005502	11-cis retinal binding
GO:0005515	protein binding
GO:0008020	G protein-coupled photoreceptor activity
GO:0008270	zinc ion binding
GO:0009881	photoreceptor activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:1990763	arrestin family protein binding

	Biological Process
GO:0000226	microtubule cytoskeleton organization
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007601	visual perception
GO:0007602	phototransduction
GO:0007603	phototransduction, visible light
GO:0009416	response to light stimulus
GO:0009583	detection of light stimulus
GO:0009642	response to light intensity
GO:0010467	gene expression
GO:0016038	absorption of visible light
GO:0016056	G protein-coupled opsin signaling pathway
GO:0043052	thermotaxis
GO:0045494	photoreceptor cell maintenance
GO:0050953	sensory perception of light stimulus
GO:0050960	detection of temperature stimulus involved in thermoception
GO:0060041	retina development in camera-type eye
GO:0071482	cellular response to light stimulus
GO:0071800	podosome assembly
GO:1904389	rod bipolar cell differentiation

	Cellular Component
GO:0000139	Golgi membrane
GO:0001750	photoreceptor outer segment
GO:0001917	photoreceptor inner segment
GO:0005794	Golgi apparatus
GO:0005886	plasma membrane
GO:0005911	cell-cell junction
GO:0016020	membrane
GO:0019867	outer membrane
GO:0042622	photoreceptor outer segment membrane
GO:0042995	cell projection
GO:0060342	photoreceptor inner segment membrane
GO:0097225	sperm midpiece
GO:0097381	photoreceptor disc membrane
GO:0097648	G protein-coupled receptor complex
GO:0120200	rod photoreceptor outer segment
GO:1990913	sperm head plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1jfp, PDBe:1jfp, PDBj:1jfp
PDBsum	1jfp
PubMed	11570894
UniProt	P02699\|OPSD_BOVIN Rhodopsin (Gene Name=RHO)

[Back to BioLiP]