Structure of PDB 1jfk Chain A

Receptor sequence

>1jfkA (length=134) Species: 5759 (Entamoeba histolytica)

MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGN
GEIDQNEFAKFYGSIQGQDLSDDKIGLKVLYKLMDVDGDGKLTKEEVTSF
FKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL

3D structure

• PDB: 1jfk NMR derived solution structure of an EF-hand calcium-binding protein from Entamoeba Histolytica.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D10 N12 D14 A16 E21	D10 N12 D14 A16 E21
BS02	CA	A	D46 D48 N50 E52 I53 E57	D46 D48 N50 E52 I53 E57
BS03	CA	A	D85 D87 D89 K91 E96	D85 D87 D89 K91 E96
BS04	CA	A	D117 N119 D121 Y123 I124 E128	D117 N119 D121 Y123 I124 E128

Gene Ontology

Molecular Function

• GO:0003779 actin binding
• GO:0003785 actin monomer binding
• GO:0005509 calcium ion binding
• GO:0046872 metal ion binding
• GO:0051015 actin filament binding

Biological Process

• GO:0006909 phagocytosis
• GO:0032231 regulation of actin filament bundle assembly
• GO:0045859 regulation of protein kinase activity
• GO:0050766 positive regulation of phagocytosis
• GO:1905303 positive regulation of macropinocytosis

Cellular Component

• GO:0001891 phagocytic cup
• GO:0005737 cytoplasm
• GO:0031143 pseudopodium
• GO:0042995 cell projection

External links

• PDB: RCSB:1jfk, PDBe:1jfk, PDBj:1jfk
• PDBsum: 1jfk
• PubMed: 11724551
• UniProt: P38505|CABP1_ENTH1 Calcium-binding protein 1 (Gene Name=CaBP1)