Structure of PDB 1jcv Chain A

Receptor sequence
>1jcvA (length=153) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEF
GDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFK
DSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIG
LTN
3D structure
PDB1jcv Unusual trigonal-planar copper configuration revealed in the atomic structure of yeast copper-zinc superoxide dismutase.
ChainA
Resolution1.55 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H46 H48 H63 H71 H80 D83 H120 R143
Catalytic site (residue number reindexed from 1) H46 H48 H63 H71 H80 D83 H120 R143
Enzyme Commision number 1.15.1.1: superoxide dismutase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CU A H46 H48 H63 H120 H46 H48 H63 H120
BS02 ZN A H63 H71 H80 D83 H63 H71 H80 D83
Gene Ontology
Molecular Function
GO:0004784 superoxide dismutase activity
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor
GO:0046872 metal ion binding
Biological Process
GO:0006801 superoxide metabolic process
GO:0006878 intracellular copper ion homeostasis
GO:0006882 intracellular zinc ion homeostasis
GO:0015680 protein maturation by copper ion transfer
GO:0019430 removal of superoxide radicals
GO:0031505 fungal-type cell wall organization
GO:0034599 cellular response to oxidative stress
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050821 protein stabilization
GO:1901856 negative regulation of cellular respiration
GO:1990748 cellular detoxification
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005829 cytosol
GO:1902693 superoxide dismutase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1jcv, PDBe:1jcv, PDBj:1jcv
PDBsum1jcv
PubMed8652572
UniProtP00445|SODC_YEAST Superoxide dismutase [Cu-Zn] (Gene Name=SOD1)

[Back to BioLiP]