Structure of PDB 1jao Chain A

Receptor sequence
>1jaoA (length=158) Species: 9606 (Homo sapiens) [Search protein sequence]
NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQG
EADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTN
TSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDI
DGIQAIYG
3D structure
PDB1jao X-ray structures of human neutrophil collagenase complexed with peptide hydroxamate and peptide thiol inhibitors. Implications for substrate binding and rational drug design.
ChainA
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H197 E198 H201 H207
Catalytic site (residue number reindexed from 1) H113 E114 H117 H123
Enzyme Commision number 3.4.24.34: neutrophil collagenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 0D3 A I159 L160 Y189 V194 H197 E198 H201 P217 N218 Y219 I75 L76 Y105 V110 H113 E114 H117 P133 N134 Y135 MOAD: Ki=1.2uM
PDBbind-CN: -logKd/Ki=5.92,Ki=1.2uM
BS02 CA A D137 G169 G171 D173 D53 G85 G87 D89
BS03 CA A D154 G155 N157 I159 D177 E180 D70 G71 N73 I75 D93 E96
BS04 ZN A H147 D149 H162 H175 H63 D65 H78 H91
BS05 ZN A H197 H201 H207 H113 H117 H123
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jao, PDBe:1jao, PDBj:1jao
PDBsum1jao
PubMed7737183
UniProtP22894|MMP8_HUMAN Neutrophil collagenase (Gene Name=MMP8)

[Back to BioLiP]