Structure of PDB 1j90 Chain A

Receptor sequence
>1j90A (length=195) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLE
LMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVEN
MRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQR
ARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADLNLE
3D structure
PDB1j90 Structural basis for substrate specificities of cellular deoxyribonucleoside kinases.
ChainA
Resolution2.56 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E52 R105
Catalytic site (residue number reindexed from 1) E35 R88
Enzyme Commision number 2.7.1.145: deoxynucleoside kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 DCZ A I29 E52 W57 Y70 F80 Q81 A110 F114 E172 I12 E35 W40 Y53 F63 Q64 A93 F97 E155
Gene Ontology
Molecular Function
GO:0004136 deoxyadenosine kinase activity
GO:0004137 deoxycytidine kinase activity
GO:0004138 deoxyguanosine kinase activity
GO:0004797 thymidine kinase activity
GO:0004849 uridine kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0019136 deoxynucleoside kinase activity
GO:0043771 cytidine kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006170 dAMP biosynthetic process
GO:0006222 UMP biosynthetic process
GO:0009157 deoxyribonucleoside monophosphate biosynthetic process
GO:0009224 CMP biosynthetic process
GO:0016310 phosphorylation
GO:0043174 nucleoside salvage
GO:0071897 DNA biosynthetic process
GO:1901293 nucleoside phosphate biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1j90, PDBe:1j90, PDBj:1j90
PDBsum1j90
PubMed11427893
UniProtQ9XZT6|DNK_DROME Deoxynucleoside kinase (Gene Name=dnk)

[Back to BioLiP]