Structure of PDB 1j7c Chain A

Receptor sequence
>1j7cA (length=98) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCA
GKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEKDLY
3D structure
PDB1j7c Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES A F39 C41 R42 G44 C46 C49 C79 F39 C41 R42 G44 C46 C49 C79
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:0022900 electron transport chain

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1j7c, PDBe:1j7c, PDBj:1j7c
PDBsum1j7c
PubMed9287153
UniProtP0A3C7|FER1_NOSS1 Ferredoxin-1 (Gene Name=petF)

[Back to BioLiP]