Structure of PDB 1j5c Chain A |
>1j5cA (length=98) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] |
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDA DTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD |
|
PDB | 1j5c The first solution structure of a paramagnetic copper(II) protein: the case of oxidized plastocyanin from the cyanobacterium Synechocystis PCC6803. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H39 C83 H86 M91 |
H39 C83 H86 M91 |
|
|
|
|