Structure of PDB 1j55 Chain A

Receptor sequence
>1j55A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence]
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLDAVDK
LLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGL
3D structure
PDB1j55 The Crystal Structure at 2A Resolution of the Ca2+-binding Protein S100P
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A S19 E22 S24 T27 E32 S19 E22 S24 T27 E32
BS02 CA A D62 N64 D66 Q68 E73 D56 N58 D60 Q62 E67
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0045296 cadherin binding
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0043542 endothelial cell migration
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0031528 microvillus membrane
GO:0034774 secretory granule lumen
GO:0042995 cell projection
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1j55, PDBe:1j55, PDBj:1j55
PDBsum1j55
PubMed12507480
UniProtP25815|S100P_HUMAN Protein S100-P (Gene Name=S100P)

[Back to BioLiP]