Structure of PDB 1j2x Chain A

Receptor sequence
>1j2xA (length=70) Species: 9606 (Homo sapiens) [Search protein sequence]
GPLDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQIL
KRLNPERKMINDKMHFSLKE
3D structure
PDB1j2x Molecular mechanism of recruitment of TFIIF- associating RNA polymerase C-terminal domain phosphatase (FCP1) by transcription factor IIF
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A T470 K471 L474 S486 E487 V490 N491 A494 K498 T23 K24 L27 S39 E40 V43 N44 A47 K51
BS02 ZN A E503 E517 E56 E70
Gene Ontology
Biological Process
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1j2x, PDBe:1j2x, PDBj:1j2x
PDBsum1j2x
PubMed12591941
UniProtP35269|T2FA_HUMAN General transcription factor IIF subunit 1 (Gene Name=GTF2F1)

[Back to BioLiP]