Structure of PDB 1iyh Chain A

Receptor sequence

>1iyhA (length=198) Species: 9606 (Homo sapiens)

PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKI
PILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSC
FPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADF
YWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL

3D structure

• PDB: 1iyh Mechanism of metal activation of human hematopoietic prostaglandin D synthase
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.18: glutathione transferase.
  5.3.99.2: prostaglandin-D synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	A	Y8 R14 K50 I51 Q63 S64	Y7 R13 K49 I50 Q62 S63

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004364 glutathione transferase activity
• GO:0004667 prostaglandin-D synthase activity
• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0016740 transferase activity
• GO:0016853 isomerase activity
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0001516 prostaglandin biosynthetic process
• GO:0006693 prostaglandin metabolic process
• GO:0007165 signal transduction
• GO:0007626 locomotory behavior
• GO:0009624 response to nematode
• GO:0010269 response to selenium ion
• GO:2000255 negative regulation of male germ cell proliferation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0043231 intracellular membrane-bounded organelle

External links

• PDB: RCSB:1iyh, PDBe:1iyh, PDBj:1iyh
• PDBsum: 1iyh
• PubMed: 12627223
• UniProt: O60760|HPGDS_HUMAN Hematopoietic prostaglandin D synthase (Gene Name=HPGDS)