Structure of PDB 1ix1 Chain A

Receptor sequence
>1ix1A (length=169) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
AILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQ
VNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYEN
VDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTL
KRDRIRKKLEKQHRQQAHH
3D structure
PDB1ix1 Crystal structure of peptide deformylase from Staphylococcus aureus in complex with actinonin, a naturally occurring antibacterial agent
ChainA
Resolution1.85 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G46 Q51 C92 L93 H134 E135 H138
Catalytic site (residue number reindexed from 1) G45 Q50 C91 L92 H133 E134 H137
Enzyme Commision number 3.5.1.88: peptide deformylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C92 H134 H138 C91 H133 H137
BS02 BB2 A G44 I45 G46 Q51 Y88 G91 C92 L93 Y99 H134 E135 H138 G43 I44 G45 Q50 Y87 G90 C91 L92 Y98 H133 E134 H137
BS03 MHA A R71 V72 D114 R115 F120 E122 R70 V71 D113 R114 F119 E121
Gene Ontology
Molecular Function
GO:0016787 hydrolase activity
GO:0042586 peptide deformylase activity
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0043686 co-translational protein modification

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ix1, PDBe:1ix1, PDBj:1ix1
PDBsum1ix1
PubMed15382235
UniProtQ9I7A8|DEF_PSEAE Peptide deformylase (Gene Name=def)

[Back to BioLiP]