Structure of PDB 1iuz Chain A

Receptor sequence
>1iuzA (length=98) Species: 3120 (Ulva pertusa) [Search protein sequence]
AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAG
VDADAISYDDYLNSKGETVVRKLSTPGVYGVYCEPHAGAGMKMTITVQ
3D structure
PDB1iuz Novel insight into the copper-ligand geometry in the crystal structure of Ulva pertusa plastocyanin at 1.6-A resolution. Structural basis for regulation of the copper site by residue 88.
ChainA
Resolution1.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H37 C84 H87 M92
Catalytic site (residue number reindexed from 1) H38 C83 H86 M91
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU A H37 C84 H87 M92 H38 C83 H86 M91
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0009055 electron transfer activity
GO:0046028 electron transporter, transferring electrons from cytochrome b6/f complex of photosystem II activity
GO:0046872 metal ion binding
Biological Process
GO:0051607 defense response to virus
Cellular Component
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009543 chloroplast thylakoid lumen
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1iuz, PDBe:1iuz, PDBj:1iuz
PDBsum1iuz
PubMed9933621
UniProtP56274|PLAS_ULVPE Plastocyanin (Gene Name=PETE)

[Back to BioLiP]