Structure of PDB 1itu Chain A

Receptor sequence
>1ituA (length=369) Species: 9606 (Homo sapiens) [Search protein sequence]
DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHT
NIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETF
LYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTL
THSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVS
VATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVN
FYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLE
DVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEE
PIPLDQLGGSCRTHYGYSS
3D structure
PDB1itu Crystal Structure of Human Renal Dipeptidase Involved in beta-Lactam Hydrolysis
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H20 D22 E125 H152 H198 H219 D288
Catalytic site (residue number reindexed from 1) H20 D22 E125 H152 H198 H219 D288
Enzyme Commision number 3.4.13.19: membrane dipeptidase.
3.5.2.6: beta-lactamase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H20 D22 E125 H20 D22 E125
BS02 ZN A E125 H198 H219 E125 H198 H219
BS03 CIL A D22 Y68 H152 H198 H219 R230 Y255 D288 G291 D22 Y68 H152 H198 H219 R230 Y255 D288 G291
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008235 metalloexopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
GO:0008800 beta-lactamase activity
GO:0016805 dipeptidase activity
GO:0034235 GPI anchor binding
GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0046872 metal ion binding
GO:0070573 metallodipeptidase activity
GO:0072341 modified amino acid binding
Biological Process
GO:0006508 proteolysis
GO:0006629 lipid metabolic process
GO:0006691 leukotriene metabolic process
GO:0006749 glutathione metabolic process
GO:0006751 glutathione catabolic process
GO:0006954 inflammatory response
GO:0016999 antibiotic metabolic process
GO:0030336 negative regulation of cell migration
GO:0030593 neutrophil chemotaxis
GO:0043066 negative regulation of apoptotic process
GO:0043154 negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0050667 homocysteine metabolic process
GO:0071277 cellular response to calcium ion
GO:0071466 cellular response to xenobiotic stimulus
GO:0071732 cellular response to nitric oxide
GO:0072340 lactam catabolic process
GO:1901749 leukotriene D4 catabolic process
Cellular Component
GO:0005615 extracellular space
GO:0005654 nucleoplasm
GO:0005886 plasma membrane
GO:0016324 apical plasma membrane
GO:0030054 cell junction
GO:0031528 microvillus membrane
GO:0042995 cell projection
GO:0045177 apical part of cell
GO:0070062 extracellular exosome
GO:0098552 side of membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1itu, PDBe:1itu, PDBj:1itu
PDBsum1itu
PubMed12144777
UniProtP16444|DPEP1_HUMAN Dipeptidase 1 (Gene Name=DPEP1)

[Back to BioLiP]