Structure of PDB 1it4 Chain A

Receptor sequence

>1it4A (length=122) Species: 1935 (Streptomyces violaceoruber)

APADKPQVLASFTQTSASSQNAWLAANRNQSAWAAYEFDWSTDLCTQAPD
NPFGFPFNTACARHDFGYRNYKAAGSFDANKSRIDSAFYEDMKRVCTGYT
GEKNTACNSTAWTYYQAVKIFG

3D structure

• PDB: 1it4 A novel prokaryotic phospholipase A2. Characterization, gene cloning, and solution structure.
• Chain: A
• Resolution: N/A

Enzymatic activity

• Catalytic site (original residue number in PDB): D43 L44 H64 D65 D85
• Catalytic site (residue number reindexed from 1): D43 L44 H64 D65 D85
• Enzyme Commision number: 3.1.1.4: phospholipase A2.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D43 L44 D65	D43 L44 D65

Gene Ontology

Molecular Function

• GO:0004623 phospholipase A2 activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006644 phospholipid metabolic process
• GO:0050482 arachidonate secretion

External links

• PDB: RCSB:1it4, PDBe:1it4, PDBj:1it4
• PDBsum: 1it4
• PubMed: 11897786
• UniProt: Q6UV28