Structure of PDB 1it1 Chain A

Receptor sequence

>1it1A (length=107) Species: 883 (Nitratidesulfovibrio vulgaris str. 'Miyazaki F')

APKAPADGLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKEDYQKCATAG
CHDNMDKKDKSAKGYYHAMHDKGTKFKSCVGCHLETAGADAAKKKELTGC
KGSKCHS

3D structure

• PDB: 1it1 Redox-coupled conformational alternations in cytochrome c(3) from D. vulgaris Miyazaki F on the basis of its reduced solution structure.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	P2 A4 P5 L9 K10 M11 F20 H22 H25 V28 C30 C33 H34 Y43 Q44 K45 C46	P2 A4 P5 L9 K10 M11 F20 H22 H25 V28 C30 C33 H34 Y43 Q44 K45 C46
BS02	HEC	A	C33 H34 H35 D42 Q44 C46 T48 C51 H52 S61 A62 H67 A68 T74 K75 S78	C33 H34 H35 D42 Q44 C46 T48 C51 H52 S61 A62 H67 A68 T74 K75 S78
BS03	HEC	A	F20 T24 H25 C33 K77 S78 C79 C82 H83 T86 E96 K104 C105	F20 T24 H25 C33 K77 S78 C79 C82 H83 T86 E96 K104 C105
BS04	HEC	A	M11 D12 K13 T14 K15 Q16 P17 V18 K57 Y65 Y66 M69 H70 C79 V80 H83 L97 T98 G99 C100 C105 H106	M11 D12 K13 T14 K15 Q16 P17 V18 K57 Y65 Y66 M69 H70 C79 V80 H83 L97 T98 G99 C100 C105 H106

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1it1, PDBe:1it1, PDBj:1it1
• PDBsum: 1it1
• PubMed: 12054869
• UniProt: P00132|CYC3_NITV9 Cytochrome c3 (Gene Name=DvMF_2499)