Structure of PDB 1irb Chain A |
>1irbA (length=123) Species: 9913 (Bos taurus) [Search protein sequence] |
ALWQFNGMIKCKIPSSEPLLDFNNYGCYCGLGGSGTPVDDLDRCCQTHDN CYKQAKKLDSCKVLVDNPYTNNYSYSCSNNEITCSSENNACEAFICNCDR NAAICFSKVPYNKEHKNLDAANC |
|
PDB | 1irb Phospholipase A2 engineering. Deletion of the C-terminus segment changes substrate specificity and uncouples calcium and substrate binding at the zwitterionic interface. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
Y28 G30 G32 D49 |
Y28 G30 G32 D49 |
|
|
|
|