Structure of PDB 1ir3 Chain A

Receptor sequence

>1ir3A (length=303) Species: 9606 (Homo sapiens)

SSVFVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVK
TVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMA
HGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVH
RDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPES
LKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQ
PDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSE
ENK

3D structure

• PDB: 1ir3 Crystal structure of the activated insulin receptor tyrosine kinase in complex with peptide substrate and ATP analog.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D1132 A1134 R1136 N1137 D1150 E1159 L1171 P1172
• Catalytic site (residue number reindexed from 1): D152 A154 R156 N157 D170 E179 L191 P192
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D1132 R1136 K1165 K1168 G1169 L1170 L1171 P1172 V1173 N1215	D152 R156 K185 K188 G189 L190 L191 P192 V193 N235
BS02	MG	A	N1137 D1150	N157 D170
BS03	ANP	A	L1002 G1005 S1006 V1010 A1028 K1030 M1079 D1083 D1150	L22 G25 S26 V30 A48 K50 M99 D103 D170

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:1ir3, PDBe:1ir3, PDBj:1ir3
• PDBsum: 1ir3
• PubMed: 9312016
• UniProt: P06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)