Structure of PDB 1ipc Chain A

Receptor sequence

>1ipcA (length=186) Species: 9606 (Homo sapiens) [Search protein sequence]

EVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALY
NHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDL
DRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAV
THIGRVYKERLGLPPKIVIGYQSHADTATTKNRFVV

3D structure

PDB

1ipc Crystal structures of 7-methylguanosine 5'-triphosphate (m(7)GTP)- and P(1)-7-methylguanosine-P(3)-adenosine-5',5'-triphosphate (m(7)GpppA)-bound human full-length eukaryotic initiation factor 4E: biological importance of the C-terminal flexible region

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MGP	A	W56 M101 W102 E103 R157 K162	W30 M75 W76 E77 R131 K136	BindingDB: Ki=28nM

Gene Ontology

	Molecular Function
GO:0000339	RNA cap binding
GO:0000340	RNA 7-methylguanosine cap binding
GO:0003723	RNA binding
GO:0003743	translation initiation factor activity
GO:0005515	protein binding
GO:0019899	enzyme binding
GO:0031370	eukaryotic initiation factor 4G binding
GO:0098808	mRNA cap binding
GO:0140297	DNA-binding transcription factor binding

	Biological Process
GO:0000082	G1/S transition of mitotic cell cycle
GO:0001662	behavioral fear response
GO:0006406	mRNA export from nucleus
GO:0006412	translation
GO:0006413	translational initiation
GO:0006417	regulation of translation
GO:0010507	negative regulation of autophagy
GO:0017148	negative regulation of translation
GO:0019827	stem cell population maintenance
GO:0030182	neuron differentiation
GO:0045665	negative regulation of neuron differentiation
GO:0045931	positive regulation of mitotic cell cycle
GO:0051028	mRNA transport
GO:0051168	nuclear export
GO:0071549	cellular response to dexamethasone stimulus
GO:0099578	regulation of translation at postsynapse, modulating synaptic transmission

	Cellular Component
GO:0000932	P-body
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0010494	cytoplasmic stress granule
GO:0016281	eukaryotic translation initiation factor 4F complex
GO:0016442	RISC complex
GO:0016604	nuclear body
GO:0016607	nuclear speck
GO:0033391	chromatoid body
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0048471	perinuclear region of cytoplasm
GO:0070062	extracellular exosome
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ipc, PDBe:1ipc, PDBj:1ipc
PDBsum	1ipc
PubMed	11879179
UniProt	P06730\|IF4E_HUMAN Eukaryotic translation initiation factor 4E (Gene Name=EIF4E)

[Back to BioLiP]