Structure of PDB 1ilq Chain A

Receptor sequence
>1ilqA (length=71) Species: 9606 (Homo sapiens) [Search protein sequence]
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCL
DPKENWVQRVVEKFLKRAENS
3D structure
PDB1ilq Structure of a CXC chemokine-receptor fragment in complex with interleukin-8.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide A Q8 I10 K11 Y13 H18 K20 F21 I40 L43 S44 D45 R47 E48 L49 Q7 I9 K10 Y12 H17 K19 F20 I39 L42 S43 D44 R46 E47 L48
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005153 interleukin-8 receptor binding
GO:0005515 protein binding
GO:0008009 chemokine activity
GO:0008201 heparin binding
GO:0045236 CXCR chemokine receptor binding
Biological Process
GO:0001525 angiogenesis
GO:0002237 response to molecule of bacterial origin
GO:0006935 chemotaxis
GO:0006952 defense response
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0008285 negative regulation of cell population proliferation
GO:0010628 positive regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0019722 calcium-mediated signaling
GO:0030155 regulation of cell adhesion
GO:0030593 neutrophil chemotaxis
GO:0031328 positive regulation of cellular biosynthetic process
GO:0031623 receptor internalization
GO:0034976 response to endoplasmic reticulum stress
GO:0035556 intracellular signal transduction
GO:0042119 neutrophil activation
GO:0044344 cellular response to fibroblast growth factor stimulus
GO:0045091 regulation of single stranded viral RNA replication via double stranded DNA intermediate
GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
GO:0045766 positive regulation of angiogenesis
GO:0048566 embryonic digestive tract development
GO:0050930 induction of positive chemotaxis
GO:0060354 negative regulation of cell adhesion molecule production
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0070098 chemokine-mediated signaling pathway
GO:0071222 cellular response to lipopolysaccharide
GO:0071347 cellular response to interleukin-1
GO:0071356 cellular response to tumor necrosis factor
GO:0090023 positive regulation of neutrophil chemotaxis
GO:2000535 regulation of entry of bacterium into host cell
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1ilq, PDBe:1ilq, PDBj:1ilq
PDBsum1ilq
PubMed10368283
UniProtP10145|IL8_HUMAN Interleukin-8 (Gene Name=CXCL8)

[Back to BioLiP]