Structure of PDB 1ijt Chain A |
>1ijtA (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] |
GIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSI FGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMF IALGKNGKTKKGNRVSPTMKVTHFLPRL |
|
PDB | 1ijt Identification of receptor and heparin binding sites in fibroblast growth factor 4 by structure-based mutagenesis. |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SO4 |
A |
G182 K183 K188 |
G104 K105 K110 |
|
|
|
|