Structure of PDB 1igv Chain A

Receptor sequence

>1igvA (length=75) Species: 9913 (Bos taurus)

KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELF
EELDKNGDGEVSFEEFQVLVKKISQ

3D structure

• PDB: 1igv Structural basis for the negative allostery between Ca(2+)- and Mg(2+)-binding in the intracellular Ca(2+)-receptor calbindin D9k.
• Chain: A
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	D54 N56 D58 E60	D54 N56 D58 E60

Gene Ontology

Molecular Function

• GO:0005499 vitamin D binding
• GO:0005509 calcium ion binding
• GO:0046872 metal ion binding
• GO:0048306 calcium-dependent protein binding

Cellular Component

• GO:0005615 extracellular space
• GO:0005737 cytoplasm

External links

• PDB: RCSB:1igv, PDBe:1igv, PDBj:1igv
• PDBsum: 1igv
• PubMed: 9194174
• UniProt: P02633|S100G_BOVIN Protein S100-G (Gene Name=S100G)